Glyma04g01120 - SoyBase

SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g01120

Feature Type:	gene_model
Chromosome:	Gm04
Start:	695288
stop:	697006
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g01120

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G39070	AT	Annotation by Michelle Graham. TAIR10: B-box zinc finger family protein \| chr4:18205061-18206421 REVERSE LENGTH=242	SoyBase	E_val: 4.00E-60	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009741	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to brassinosteroid stimulus	SoyBase	N/A	ISS
GO:0010200	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to chitin	SoyBase	N/A	ISS
GO:0080167	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to karrikin	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
PF00643	PFAM	B-box zinc finger	JGI		ISS
UniRef100_G7J7R4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Salt tolerance protein n=1 Tax=Medicago truncatula RepID=G7J7R4_MEDTR	SoyBase	E_val: 5.00E-98	ISS
UniRef100_I1JSK5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JSK5_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma04g01120

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g01120

Paralog	Evidence	Comments
Glyma06g01140	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g01120 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g009200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g01120

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g01120

Limit To All Plant Sequences

>Glyma04g01120.1   sequence type=CDS   gene model=Glyma04g01120   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGATCCAGTGTGCTGTGTGTGACAAAGTGGAAGCCTCCGTCTTCTGCTCTGCAGATGAAGCTGCTCTTTGCCATAGTTGTGACCGCACCATTCACCACGCCAACAAGCTTGCAACCAAACACCCACGCTTCTCTCTCCATTACCCCACCTCCCAAGACTTCCCTCTTTGTGATATTTGCCAAGAGAGGCGTGCATATCTATTTTGCCAAGAAGACAGGGCATTGCTATGCAGGGAGTGTGACGTTCCTATCCACAGGGCGAATGAGCATACCCAGAAGCATAACAGGTTTCTTCTCACCGGAGTGAAGCTCTCTGGTACTTCTTTGGATCCTGCTGCGTCCTCCACCAATTGCACCCATGGCTCTGAAGGAAGAAACAACGCTCGATCTAGAATGAACAGACCCAGATCATCAGTTTCCAATGAAGAAAATGCAAGTAATTCTTCTTGCAAGGTTGAAGACAACGTGGCTAGTGACACTGGTTCGGTTTCAACTAGCAGCATTTCTGAGTACTTGATCGAAACAATACCCGGTTACTGTTTTGAAGACCTTCTTGATGCTTCATTTGCACCTAATGGTTTCTGTAAGAACCAGAACTATGATCGTCATAGGCGTTTCAGGACCAAGATCTTCAAGTTATTAGGACGTGTTTGGTTTGAGTTAAGGAGATTCCAAAATCTTAACGCTATCGATGATCAACTGTTTGTAAAAATCTGTTGGAAAATATCTTCTTTTGTTTTTGTTATTTGCATTTCTTTTTGGGCTCCCTGCTGCATTCTTTATGATTTTTTTTTCATTCTCTATTCCCGACCACTGTTTCGGCCTCTTATTTTAGTATTTTTTTCAATTTTCATTGGGTTAATTAATAATATTTTTTGGGGGGGGGTCCATGCTTTTATTGACATGAACATGAATTCATTGAATAACGCAACTGAATATTATGTGCCACTTTCTTAA

Predicted protein sequences of Glyma04g01120

Limit To All Plant Sequences

>Glyma04g01120.1   sequence type=predicted peptide   gene model=Glyma04g01120   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKIQCAVCDKVEASVFCSADEAALCHSCDRTIHHANKLATKHPRFSLHYPTSQDFPLCDICQERRAYLFCQEDRALLCRECDVPIHRANEHTQKHNRFLLTGVKLSGTSLDPAASSTNCTHGSEGRNNARSRMNRPRSSVSNEENASNSSCKVEDNVASDTGSVSTSSISEYLIETIPGYCFEDLLDASFAPNGFCKNQNYDRHRRFRTKIFKLLGRVWFELRRFQNLNAIDDQLFVKICWKISSFVFVICISFWAPCCILYDFFFILYSRPLFRPLILVFFSIFIGLINNIFWGGVHAFIDMNMNSLNNATEYYVPLS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain